PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G198300.1.p
Common NameGLYMA_06G198300, LOC100784971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 413aa    MW: 46296.4 Da    PI: 4.5391
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G198300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK53.64.5e-17311359452
               RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++l+dls  F+l+i +AA +L+v+ +++K iCR+  +kRWP+Rk++sl
  Glyma.06G198300.1.p 311 RMTLSDLSGVFHLTISAAAVKLDVSNSTVKSICRRGKLKRWPQRKVQSL 359
                          689*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.22299380IPR003035RWP-RK domain
PfamPF020421.1E-16312359IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDNNNNNSGF VPNNDTDDDC TFLQTLLEMD PQHFYLPTEE FDSLSQQQQQ KNDPFGVEKG  60
NKVSFLQGNN NNDFPIGEGV VPDVVDVEEE EGPPRGAGKE LIPEGQGDRF FIHGDDIFFF  120
GEGGVGNNVD PPQENQTQPP NNQDVRSLCP WPPPPEPFSC SCCEVLRQIN YTNGVRFDKL  180
EIHGTVGVIN HAICHVEDKT SNRPPRDTYQ IIDFCNKNTE EIRNFLNVYC KERIEAGFIP  240
IEDPSMSAFY DALCTGMDWT EVSNDVDDDL GPPNGTEQES ESEPEAGNGR RASTSRPRRR  300
DMAVQRQRVP RMTLSDLSGV FHLTISAAAV KLDVSNSTVK SICRRGKLKR WPQRKVQSLA  360
KKVRVLVRAL NSPDPGVKRR TQDEIRRLQK EIIENCGGIT PTGIPMLQFD EE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014632063.10.0PREDICTED: uncharacterized protein LOC100784971
TrEMBLK7KW170.0K7KW17_SOYBN; Uncharacterized protein
STRINGGLYMA06G21406.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Representative plantOGRP1033348